Gene Rv2695
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical alanine rich protein |
| Comments | Rv2695, (MTCY05A6.16), len: 235 aa. Conserved hypothetical ala-rich protein, equivalent to Q49994|ML1030|U1764L hypothetical protein from Mycobacterium leprae (232 aa), FASTA scores: opt: 1166, E(): 6.3e-63, (76.95% identity in 230 aa overlap). Also shows some similarity with other hypothetical proteins e.g. Q986S2|MLR7232 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (277 aa), FASTA scores: opt: 150, E(): 0.059, (33.55% identity in 173 aa overlap); CAC47772|SMC03810 hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (269 aa), FASTA scores: opt: 143, E(): 0.15, (28.05% identity in 228 aa overlap); Q9A5N6|CC2411 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase from Caulobacter crescentus (393 aa), FASTA scores: opt: 138, E(): 0.41, (26.45% identity in 238 aa overlap); etc. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Nucleotide position 3012293 in the genome sequence has been corrected, A:G resulting in T126T. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3011916 | 3012623 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2695|Rv2695
MAVDLDGVTTVLLPGTGSDNDYVRRAFSAPLRRAGAVLVTPVPHPGRLIDGYRAALDDAARDGPVVVGGVSLGAAVAAAWALEHPDRAVAVLAALPAWTGEPELAPAAQAARYTAARLRCDGLAATTTRMRASSPVWLAEELTRSWRVQWPELPDAMEEAAAYVAPSRAELARLVAPLAVAAAVDDPIHPLQVAADWVSVAPHAALRTVTLDEIGADAAALGSACLAALAEVSGA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
