Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2705c, (MTCY05A6.26c), len: 129 aa (unlikely ORF). Conserved hypothetical protein, similar to others e.g. Q9RXR5|DR0242 conserved hypothetical protein from Deinococcus radiodurans (112 aa), FASTA scores: opt: 259, E(): 9.4e-10, (40.5% identity in 116 aa overlap); CAC45122|SMC02246 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (115 aa), FASTA scores: opt: 208, E(): 1.6e-06, (38.3% identity in 107 aa overlap); Q98B88|MLL5682 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (116 aa), FASTA scores: opt: 173, E(): 0.00026, (34.95% identity in 103 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30198143020203-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2705c|Rv2705c
VRMTPDPAMLVHLCGVQEWSHARERGGIYPESDKTGYIHLSTLEQVHLPANRLYRGRADLVLLYIDPAALDSPVRWEPGVPTDPRSMLFPHLYGPLPVRAVIGAAAYPPAGDGSFGPAPEFRSATADPT