Gene Rv2721c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane alanine and glycine rich protein |
| Comments | Rv2721c, (MTCY05A6.42c, MTCY154.01c), len: 699 aa. Possible conserved transmembrane ala-, gly-rich protein, equivalent to Q49837|ML1002|U2235I possible conserved membrane protein from Mycobacterium leprae (687 aa), FASTA scores: opt: 2703, E(): 6.6e-135, (60.3% identity in 713 aa overlap). Shows some similaity to Q01377|CSP1 PS1 protein precursor (secreted protein) from Corynebacterium glutamicum (Brevibacterium flavum) (657 aa), FASTA scores: opt: 276, E(): 3.8e-07, (29.4% identity in 272 aa overlap); and Q9KIJ0 Rv2721c-like protein from Mycobacterium paratuberculosis (246 aa), FASTA scores: opt: 178, E(): 0.025, (37.5% identity in 120 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3032520 | 3034619 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2721c|Rv2721c
VNGQRGQLSTLIGRTLLGLAATAVTAVLLAPTVAASPMGDAEDAMMAAWEKAGGDTSTLGVRKGDVYPIGDGFALDFAGGKMFFTPATGAKYLYGPLLDKYESLGGAADSDLGFPTINEVPGLAGPDSRVSTFSAADNPVIFWTPEHGAFVVRGALNAAWDKLGSSGGVLGAPVGDETYDGEVTAQKFSGGEVSWNRATKEFTTVPAVLAEQLKGLQVAIDPSAAINMAWRAAGGAAGPLGAKKGGQYPIGGDGIAQDFVGGKVFFSPATGANAVEGEILAKYESLGGPVSSDLGFPIANETDGGFGPSSRIVRFSAADKPVIFWTPDHGAFVVRGAMVAAWDKLRGPNGKLGAPVGDQTVDGDVVSQKFTGGMISWNRAKNTFTTDPANLAPLLSGLQVSGQNQPSTSAMPPPGKKFTWHWWWLGAAALGVLLVVMVALVVFGLRRRRRGYDAAAYDDDRAGDVEYGTAADGDWPPDEDFGSEHFGFGDQFPPEPVAPDAGSTPRVSWPRGAGAAVGDAEHLPGEEGYGSDLLSGPSNVGVEEEDTDAVDTTPTPVVSQADLSEVGPDLIVPERVVPETFVPQAFVPEAVAPEAVPPDVHAADLADTGLPAAAVSAAEDRGGRHAAAEPPEPPSAGVRPAIHLPLEDPYQMPNGYPVKASVSFGLYYPPGSALYHDTLAELWFASEEVAQVNGFIRAD
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
