Gene Rv2734
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2734, (MTCY154.14), len: 284 aa. Conserved hypothetical protein, highly similar to various proteins e.g. Q984J2|MLR7981 ABC transporter ATP-binding protein from Rhizobium loti (Mesorhizobium loti) (286 aa), FASTA scores: opt: 877, E(): 9e-50, (52.45% identity in 246 aa overlap) (N-terminus longer); Q98DH1|MLL4707 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (249 aa), FASTA scores: opt: 829, E(): 1.1e-46, (50.4% identity in 244 aa overlap); AAK65865|SMA2239 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (259 aa), FASTA scores: opt: 796, E(): 1.5e-44, (50.0% identity in 252 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3046821 | 3047675 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2734|Rv2734
MSDRSAIEWTGATWNPVTGCDRVSPGCDHCYAMTLAKRLKAMGSDKYQTDGDPRTSGPGFGVTIHPRSLDEPFRWRSPRTVFVNSMADLFHARVALWFIREVFEVMRATPQHTYQILTKRSLRLRRLAHKLEWPSNVWMGVSVENVDAFRRIEDLRQVPAAVRFLSCEPLLGPLDGINLGSIDWVIAGGESGPNFRPIDPQWVRHIRDTCTAADVPFFFKQWGGRTPKAFGRELDGRCWDEMPLIEIRNPDPRTTSRVHADPMLATAPTESAQRSNPGQLVRQR
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
