Gene Rv2742c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical arginine rich protein |
| Comments | Rv2742c, (MTV002.07c), len: 277 aa (questionable ORF). Conserved hypothetical arg-rich protein. Extreme N-terminus is highly similar to the N-teminus of Q9CCC1ML0986 hypothetical protein from Mycobacterium leprae (67 aa), FASTA scores: opt: 183, E(): 0.00052, (71.05% identity in 38 aa overlap); and to the downstream ORF O33281|Rv2738c|MTV002.03c conserved hypothetical protein from Mycobacterium tuberculosis (68 aa), FASTA scores: opt: 200, E(): 5.5e-05, (78.4% identity in 37 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3055515 | 3056348 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2742c|Rv2742c
VLVDELGVKIVHAQHVPAPYLVQRMREIHERDENRQRHAQVDVQRRRDQPERGQHQHRRNRDADHHPDGRTLAGQIVAHPVSHRVRQPRPVAIADVLPRVGPRADCVVAHSLQGSPRRRERRRGQTAHQRLGRRSGNAIACPLYLENAAGPEPDTKRAEGRRFGAFGGGDLRWMADRVPRQGSGRRGLGSRSGAGVPQGADARGWRHTADGVPRVGQPAIRRGVPGFWCWLDHVLTGFGGRNAICAIEDGVEPRVAWWALCTDFDVPRSMGRRTPGG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
