Gene Rv2751
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2751, (MTV002.16), len: 296 aa. Conserved protein, similar in part to others e.g. Q98LR1|MLR0915 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (299 aa), FASTA scores: opt: 279, E(): 1.6e-11, (32.85% identity in 210 aa overlap); Q9FBX1|SC8E7.10 conserved hypothetical protein from Streptomyces coelicolor (283 aa), FASTA scores: opt: 232, E(): 2.4e-08, (27.9% identity in 269 aa overlap); Q9FMY9 hypothetical protein (genomic DNA, chromosome 5, P1 clone:MJB21) from Arabidopsis thaliana (Mouse-ear cress) (370 aa), FASTA scores: opt: 205, E(): 2.1e-06, (28.9% identity in 211 aa overlap); etc. Also similar in part to several proteins from Mycobacterium tuberculosis: P72053|Rv3787c|MTCY13D12.21 hypothetical 33.4 KDA protein (308 aa), FASTA scores: opt: 266, E(): 1.3e-10, (29.6% identity in 267 aa overlap); O53795|MBE50c|Rv0731c|MTV041.05c hypothetical 34.9 KDA protein (318 aa), FASTA scores: opt: 266, E(): 1.3e-10, (32.05% identity in 281 aa overlap); O53841|Rv0830|MTV043.22 hypothetical 33.4 KDA protein (301 aa), FASTA scores: opt: 263, E(): 2e-10, (31.3% identity in 262 aa overlap); etc. Belongs to the MTCY13D12.21 / MTCY210.45C / MTCY78.29C family. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3063638 | 3064528 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2751|Rv2751
MARNPAAQTAFGPMVLAAVEQNEPPGRRLVDDDLADLFLPRPLRWLAGATRSAVLRRLLISASEWSGRGLWANLACRKRFIGDKLDEALGDIDAVVILGAGLDTRAYRLTRRVRMPVFEVDLPVNIARKAKTVRRVLGELPLSVRLVALDFEHDDLLTALAEHGYRTEYRVFFVCEGVTQYLTERAVRRTLEGLRAAAPGSRMVFTYVRRDFIDGTNRYGTRTLYHTVRQRRQLWHFGLDPEEVAGFLADYGWRLTEQAGPEELVQRYVEPTGRNLNASQIEWSAYAEKSEPVTPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant