Gene Rv2765
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable alanine rich hydrolase |
| Comments | Rv2765, (MTV002.30), len: 245 aa. Probable ala-rich hydrolase, similar to various hydrolases or hypothetical proteins e.g. Q9KYM6|SC9H11.13c putative hydrolase from Streptomyces coelicolor (251 aa), FASTA scores: opt: 630, E(): 1.4e-33, (43.1% identity in 246 aa overlap); Q9A5T9|CC2358 dienelactone hydrolase family protein from Caulobacter crescentus (286 aa), FASTA scores: opt: 592, E(): 4.5e-31, (38.45% identity in 242 aa overlap); Q9FCF1|2SCD46.33 putative hydrolase (dienelactone hydrolase family) from Streptomyces coelicolor (254 aa), FASTA scores: opt: 500, E(): 3.9e-25, (37.7% identity in 252 aa overlap); P73163|DLHH_SYNY3|SLL1298 putative carboxymethylenebutenolidase (dienelactone hydrolase) from Synechocystis sp. (strain PCC 6803) (246 aa), FASTA scores: opt: 276, E(): 1.3e-10, (26.95% identity in 230 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3074636 | 3075373 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2765|Rv2765
MPKTTDTAATPDGTCAVRLFTPDGPGRWPGVVMFPDAGGVRDTFDRMAAKLAGFGYVVLLPDVYYREGDWAPFDMKTAFGDPQERARIMFMIGTLTPDRVTRDADALLNYLASRPEVIGDRFGVCGYCMGGRMSVVVAGRLPDRVAAAAAFHPGGLVANSPDSPHLLADRISATVYIGGAENDPSFTADHAEKLDKAFSAAGVPHRIECYPAAHGFAVPDNPSYDAAADERHWAAMTETFGAALN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant