Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in biosynthesis of diaminopimelate and lysine from aspartate semialdehyde (at the second step) [catalytic activity: 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) = 2,3-dihydrodipicolinate + NAD(P)H].
ProductDihydrodipicolinate reductase DapB (DHPR)
CommentsRv2773c, (MTV002.38c), len: 245 aa. DapB, dihydrodipicolinate reductase (see Pavelka et al., 1997), highly similar to many e.g. P40110|DAPB_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (248 aa), FASTA scores: opt: 1030, E(): 1.8e-58, (65.45% identity in 246 aa overlap); O86836|DAPB_STRCO|SC9A10.03 from Streptomyces coelicolor (250 aa), FASTA scores: opt: 997, E(): 2.3e-56, (61.15% identity in 247 aa overlap); P42976|DAPB_BACSU from Bacillus subtilis (267 aa), FASTA scores: opt: 608, E(): 1.7e-31, (45.95% identity in 209 aa overlap); P46829|DAPB_MYCBO from Mycobacterium bovis (see Cirillo et al., 1994) (271 aa), FASTA scores: opt: 505, E(): 6.3e-25, (36.2% identity in 246 aa overlap); etc. Belongs to the dihydrodipicolinate reductase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 3_296 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30816043082341-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2773c|dapB
MRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
      
Bibliography