Gene Rv2776c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable oxidoreductase |
| Comments | Rv2776c, (MTV002.41c), len: 309 aa. Probable oxidoreductase, similar to other oxidoreductases e.g. Q9KZ15|SC10B7.17 putative iron-sulfur oxidoreductase from Streptomyces coelicolor (364 aa), FASTA scores: opt: 846, E(): 1.2e-45, (46.75% identity in 308 aa overlap); O88034|SC5A7.28c iron-sulfur oxidoreductase beta subunit from Streptomyces coelicolor (313 aa), FASTA scores: opt: 745, E(): 2.3e-39, (41.45% identity in 316 aa overlap); P33164|PDR_BURCE|OPHA1 phthalate dioxygenase reductase from Burkholderia cepacia (Pseudomonas cepacia) (321 aa), FASTA scores: opt: 616, E(): 2.9e-31, (33.65% identity in 309 aa overlap); etc. Equivalent to AAK47165 from Mycobacterium tuberculosis strain CDC1551 (363 aa) but shorter 54 aa. Contains PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature and PS00063 Aldo/keto reductase family putative active site signature. Seems to belong to the 2FE2S plant-type ferredoxin family in the C-terminal section. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3083374 | 3084303 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2776c|Rv2776c
VRRTNPAVVTKRELVAPDVVALTLADPGGGLLPAWSPGGHIDVQLPSGRRRQYSLCGVPGRRTDYRIAIRRIADGGGGSIEMHEAFDVGDTCEFEGPRNAFHLGLAERDVLFVIGGIGVTPILPMIRAAEQRGIDWRAIYAGRGREYMPFLDEVVAVAPGRVTVWADDEHGRFASVDELLAGAGPTTAVYVCGPPGMLEAVRVARNQHADAPLHYERFSPPPVVDGVPFELELARSRRVLRVPANRSALDVMLDWDPTTAYSCQQGFCGTCKVRVLAGQVDRRGRIIEGDNEMLVCVSRAVSGRVVIDA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
