Gene Rv2781c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible alanine rich oxidoreductase |
| Comments | Rv2781c, (MTV002.46c), len: 344 aa. Possible ala-rich oxidoreductase, similar to various oxidoreductases or hypothetical proteins e.g. Q9RDD8|SCC77.20c putative oxidoreductase from Streptomyces coelicolor (364 aa), FASTA scores: opt: 912, E(): 5.3e-47, (45.55% identity in 336 aa overlap); Q9FDD4|2-NPDL putative 2-nitropropane dioxygenase from Streptomyces ansochromogenes (363 aa), FASTA scores: opt: 869, E(): 1.9e-44, (44.2% identity in 337 aa overlap); O05413|YRPB 2-nitropropane dioxygenase from Bacillus subtilis (347 aa), FASTA scores: opt: 560, E(): 4.9e-26, (33.75% identity in 317 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3087950 | 3088984 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2781c|Rv2781c
MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLADDIAAARAATTGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVGQPVYGDDDDWVRKLEVVADVRPEVVSFTFGAPPPDVVQRLSALGLLVSITVTSVYEAGVAIAAGADSLVVQGPAAGGHRGTFAPDMEPGTESLHQLLDRIGSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLADEAGTNAAHRAALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKPIRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
