Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible alanine rich oxidoreductase
CommentsRv2781c, (MTV002.46c), len: 344 aa. Possible ala-rich oxidoreductase, similar to various oxidoreductases or hypothetical proteins e.g. Q9RDD8|SCC77.20c putative oxidoreductase from Streptomyces coelicolor (364 aa), FASTA scores: opt: 912, E(): 5.3e-47, (45.55% identity in 336 aa overlap); Q9FDD4|2-NPDL putative 2-nitropropane dioxygenase from Streptomyces ansochromogenes (363 aa), FASTA scores: opt: 869, E(): 1.9e-44, (44.2% identity in 337 aa overlap); O05413|YRPB 2-nitropropane dioxygenase from Bacillus subtilis (347 aa), FASTA scores: opt: 560, E(): 4.9e-26, (33.75% identity in 317 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30879503088984-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2781c|Rv2781c
MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLADDIAAARAATTGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVGQPVYGDDDDWVRKLEVVADVRPEVVSFTFGAPPPDVVQRLSALGLLVSITVTSVYEAGVAIAAGADSLVVQGPAAGGHRGTFAPDMEPGTESLHQLLDRIGSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLADEAGTNAAHRAALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKPIRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA