Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2816c, (MTCY16B7.27), len: 113 aa. Conserved hypothetical protein, highly similar in part to N-terminus of several proteins e.g. O28403|AF1876 conserved hypothetical protein from Archaeoglobus fulgidus (94 aa), FASTA scores: opt: 137, E(): 0.0022, (47.55% identity in 61 aa overlap); Q97Y85|SSO8090 hypothetical protein from Sulfolobus solfataricus (88 aa), FASTA scores: opt: 124, E(): 0.02, (37.3% identity in 59 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31236253123966-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2816c|Rv2816c
MPTRSREEYFNLPLKVDESSGTIGKMFVLVIYDISDNRRRASLAKILAGFGYRVQESAFEAMLTKGQLAKLVARIDRFAIDCDNIRIYKIRGVAAVTFYGRGRLVSAEEFVFF