Gene Rv2834c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of Sn-glycerol-3-phosphate across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpE |
| Comments | Rv2834c, (MTCY16B7.08), len: 275 aa. Probable ugpE, Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter (see citation below), similar to various permeases e.g. Q9KDY3|BH1078 glycerol-3-phosphate ABC transporter from Bacillus halodurans (270 aa), FASTA scores: opt: 620, E(): 4.3e-32, (34.7% identity in 268 aa overlap); Q9X0K6|TM1122 glycerol-3-phosphate ABC transporter permease protein from Thermotoga maritima (276 aa), FASTA scores: opt: 605, E(): 3.9e-31, (32.5% identity in 274 aa overlap); AAG58557|UGPE SN-glycerol 3-phosphate transport system (integral membrane protein) from Escherichia coli strain O157:H7 and EDL933 (281 aa), FASTA scores: opt: 574, E(): 3.7e-29, (32.95% identity in 264 aa overlap); P10906|UGPE_ECOLI|B3451 SN-glycerol-3-phosphate transport system permease protein from Escherichia coli strain K12 (281 aa), FASTA scores: opt: 569, E(): 7.6e-29, (32.6% identity in 264 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3140487 | 3141314 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2834c|ugpE
VTPDRLRSSVGYAAMLLVVTLIAGPLLFVFFTSFKDQPDIYAQPTSWWPLRWYPQNYRTATEQIPFWTFLRNSLIITSVLAVVKFTLGVLSAFGLVFVRFPGRTAVFLVIIAALMVPNQITVISNYALISHLGLRNTFAGIILPLAGVAFGTFLMRNHFLSLPAEIIEAARMDGARWWQLLLRVVLPMSRPTMVAVGVITVVNEWNEYLWPFLMSDDESVAPLPIGLTFLQQAEGVTNWGPVMAVTLLAMLPILLVFIALQRQMIKGLTSGAVKG
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant