Gene Rv2849c (cobA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in cobalamin biosynthesis; transforms cobyrinic acid into cobinamide [catalytic activity: ATP + cob(I)alamin + H(2)O = orthophosphate + pyrophosphate + adenosylcobalamin]. |
| Product | Probable cob(I)alamin adenosyltransferase CobO (corrinoid adenosyltransferase) (corrinoid adotransferase activity) |
| Comments | Rv2849c, (MTCY24A1.08), len: 207 aa. Probable cobO, cob(I)alamin adenosyltransferase, highly similar to Q9RJ17|COBO from Streptomyces coelicolor (199 aa), FASTA scores: opt: 918, E(): 1.1e-55, (64.75% identity in 207 aa overlap); and similar to others e.g. O30785|COBO from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (212 aa), FASTA scores: opt: 329, E(): 2.8e-15, (44.3% identity in 185 aa overlap); P29930|COBO_PSEDE from Pseudomonas denitrificans (213 aa), FASTA scores: opt: 280, E(): 6.5e-12, (38.9% identity in 185 aa overlap); P31570|BTUR_SALTY|COBA from Salmonella typhimurium (196 aa), FASTA scores: opt: 278, E(): 8.4e-12, (39.8% identity in 196 aa overlap); etc. Cofactor: manganese. Note that previously known as cobA. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3157521 | 3158144 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2849c|cobO
MPQGNPLAVPNDGLTTRARRNMPILAVHTGEGKGKSTAAFGMALRAWNAGLDIAVFQFVKSAKWKVGEEAAFRQLGRLHDQHGIGGAVEWHKMGAGWSWTRTSRKAGTDVDRAAAAADGWAEIALRLATQRHDFYLLDEFTYPLKWGWLDVDEVVDVLRARPGHQHVVITGRDAPQRLVAAADLVTEMTKVKHPMDAGRKGQKGIEW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
