Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in cobalamin biosynthesis; transforms cobyrinic acid into cobinamide [catalytic activity: ATP + cob(I)alamin + H(2)O = orthophosphate + pyrophosphate + adenosylcobalamin].
ProductProbable cob(I)alamin adenosyltransferase CobO (corrinoid adenosyltransferase) (corrinoid adotransferase activity)
CommentsRv2849c, (MTCY24A1.08), len: 207 aa. Probable cobO, cob(I)alamin adenosyltransferase, highly similar to Q9RJ17|COBO from Streptomyces coelicolor (199 aa), FASTA scores: opt: 918, E(): 1.1e-55, (64.75% identity in 207 aa overlap); and similar to others e.g. O30785|COBO from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (212 aa), FASTA scores: opt: 329, E(): 2.8e-15, (44.3% identity in 185 aa overlap); P29930|COBO_PSEDE from Pseudomonas denitrificans (213 aa), FASTA scores: opt: 280, E(): 6.5e-12, (38.9% identity in 185 aa overlap); P31570|BTUR_SALTY|COBA from Salmonella typhimurium (196 aa), FASTA scores: opt: 278, E(): 8.4e-12, (39.8% identity in 196 aa overlap); etc. Cofactor: manganese. Note that previously known as cobA.
Functional categoryIntermediary metabolism and respiration
ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31575213158144-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2849c|cobO
MPQGNPLAVPNDGLTTRARRNMPILAVHTGEGKGKSTAAFGMALRAWNAGLDIAVFQFVKSAKWKVGEEAAFRQLGRLHDQHGIGGAVEWHKMGAGWSWTRTSRKAGTDVDRAAAAADGWAEIALRLATQRHDFYLLDEFTYPLKWGWLDVDEVVDVLRARPGHQHVVITGRDAPQRLVAAADLVTEMTKVKHPMDAGRKGQKGIEW