Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductUnknown protein
CommentsRv2854, (MTCY24A1.03c), len: 346 aa. Unknown protein, showing similarity with Q9CD03|ML2603 hypothetical protein from Mycobacterium leprae (279 aa), FASTA scores: opt: 154, E(): 0.0083, (33.35% identity in 87 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31641523165192+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2854|Rv2854
VTGWVPDVLPGYWQCTIPLGPDPDDEGDIVATLVGRGPQTGKARGDTTGAHHTVLAVHGYTDYFFHTELADHFANRGFAFYALDLRKCGRSRAPGQTPHFITDLARYDTELEHSLSIINEQNRSAKVLVYGHSAGGLIVSLWLDRLRQRGEITRAGVTGLVLNSPFLDLQGPAILRLPLTSAFFAAMARMRPKWVARPPKEGGYGCTLHRDYDGEFDYNLQWKPVGGFPVTFGWIHASRRGHARLHRGIDVGVPNLILCSDHTVREKADPATLHRGDAVLDVTHITRWAGCIGNRSTVIAVADAKHDVFLSLPQPRQMAYRRLDLWLDDYLGTHNDTDASASSGKG