Gene Rv2895c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in intracellular removal of iron from iron-mycobactin complex. Mycobactin is an iron-chelating compound involved in the transport of iron from the bacterial environment into the cell cytoplasm. |
| Product | Possible mycobactin utilization protein ViuB |
| Comments | Rv2895c, (MT2963, MTCY274.26c), len: 283 aa. Possible viuB, mycobactin utilization protein, highly similar to Q9RJ78|SCI41.06 hypothetical 31.5 KDA protein from Streptomyces coelicolor (280 aa), FASTA scores: opt: 639, E(): 5.1e-32, (46.3% identity in 285 aa overlap); and similar to other proteins e.g. Q9F641|MXCB protein of the biosynthetic gene cluster of the myxochelin-type iron chelator from Stigmatella aurantiaca (270 aa), FASTA scores: opt: 417, E(): 2.2e-18, (34.2% identity in 263 aa overlap); Q56646|VIUB_VIBCH|VC2210 vibriobactin utilization protein from Vibrio cholerae (271 aa), FASTA scores: opt: 395, E(): 5.1e-17, (31.0% identity in 274 aa overlap); Q56743|VIUB_VIBVU vulnibactin utilization protein V from Vibrio vulnificus (271 aa), FASTA scores: opt: 390, E(): 1e-16, (33.95% identity in 274 aa overlap); etc. Equivalent to AAK47289 from Mycobacterium tuberculosis strain CDC1551 (321 aa) but shorter 38 aa. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by Western blot in the cytoplasmic membrane fraction of M. tuberculosis H37Rv and not the cell wall or cytosol (See Farhana et al., 2008). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3204381 | 3205232 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2895c|viuB
VAGRPLHAFEVVATRHLAPHMVRVVLGGSGFDTFVPSDFTDSYIKLVFVDDDVDVGRLPRPLTLDSFADLPTAKRPPVRTMTVRHVDAAAREIAVDIVLHGEHGVAGPWAAGAQRGQPIYLMGPGGAYAPDPAADWHLLAGDESAIPAIAAALEALPPDAIGRAFIEVAGPDDEIGLTAPDAVEVNWVYRGGRADLVPEDRAGDHAPLIEAVTTTAWLPGQVHVFIHGEAQAVMHNLRPYVRNERGVDAKWASSISGYWRRGRTEEMFRKWKKELAEAEAGTH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Farhana A et al. [2008]. Mechanistic insights into a novel exporter-importer system of Mycobacterium tuberculosis unravel its role in trafficking of iron. Localization
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant