Gene Rv2910c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2910c, (MTCY274.42c), len: 147 aa. Conserved hypothetical protein, showing some similarity with hypothetical proteins from other organisms e.g. Q9JN76|MMYY hypothetical 17.4 KDA protein from Streptomyces coelicolor (153 aa), FASTA scores: opt: 164, E(): 0.00026, (35.05% identity in 129 aa overlap); etc. Also some similarity with protein from Mycobacterium tuberculosis e.g. O07237|Rv0310c|MTCY63.15c (163 aa), FASTA scores: opt: 165, E(): 0.00023, (26.3% identity in 137 aa overlap); P96815|Rv0138|MTCI5.12 (167 aa), FASTA scores: opt: 132, E(): 0.048, (30.25% identity in 109 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3217827 | 3218270 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2910c|Rv2910c
MCAVLDRSMLSVAEISDRLEIQQLLVDYSSAIDQRRFDDLDRVFTPDAYIDYRALGGIDGRYPKIKQWLSQVLGNFPVYAHMLGNFSVRVDGDTASSRVICFNPMVFAGDRQQVLFCGLWYDDDFVRTPDGWRIIRRVETKCFQKMM
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
