Gene Rv2922A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in cellular metabolism [catalytic activity: an acylphosphate + H(2)O = a fatty acid anion + orthophosphate]. |
| Product | Probable acylphosphatase AcyP (acylphosphate phosphohydrolase) |
| Comments | Rv2922A, len: 93 aa. Probable acyP, acylphosphatase (acylphosphate phosphohydrolase), highly similar to others e.g. Q9ZBQ3|SC7A1.20 putative acylphosphatase from Streptomyces coelicolor (93 aa), FASTA scores: opt: 345, E(): 9.5e-19, (58.9% identity in 90 aa overlap); P75877|ACYP_ECOLI|YCCX|B0968|Z1320|ECS1052 putative acylphosphatase from Escherichia coli strains K12 and O157:H7 (92 aa), FASTA scores: opt: 220, E(): 2e-09, (44.95% identity in 89 aa overlap); Q9RVU3|DR0929 putative acylphosphatase from Deinococcus radiodurans (87 aa), FASTA scores: opt: 193, E(): 2.1e-07, (44.3% identity in 79 aa overlap); etc. Belongs to the acylphosphatase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3237818 | 3238099 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2922A|acyP
MSAPDVRLTAWVHGWVQGVGFRWWTRCRALELGLTGYAANHADGRVLVVAQGPRAACQKLLQLLQGDTTPGRVAKVVADWSQSTEQITGFSER
Bibliography
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
