Gene Rv2944
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS1533 |
| Product | Possible transposase for insertion sequence element IS1533 |
| Comments | Rv2944, (MTCY24G1.05c), len: 238 aa. Possible transposase for IS1533, similar to is-element proteins e.g. P15026|ISTB_ECOLI istb protein from Escherichia coli (265 aa), FASTA scores: opt: 475, E (): 1.6e-21, (48.0% identity in 148 aa overlap); Z95436|MTY15C10_14 from Mycobacterium tuberculosis (248 aa), FASTA scores: opt: 784, E(): 0, (87.4% identity in 135 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3289790 | 3290506 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2944|Rv2944
VSQCPGWPIAPAPRTGATKNTWPPACSGKCQPGSPMVVRAASAPPASRLGSRWKSSTLSMLVASNATPSHIWAPWISSPPAITSCFWAPPGTGKTHLAVGLAIRACQAGHRVLFATAAEWVARLAEAHHAGRIYAELTRLCRYPLLVVDEVGYIPFEPEAANLFFQLVSSRYERASLIVTSNKAFGRWGEVFGGDDVVAAAMIDRLVHHAEVVALKGDSYRLKDRDLGRVPPAGTTEE
Bibliography
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
