Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; lipolytic enzyme involved in cellular metabolism.
ProductProbable lipase/esterase LipN
CommentsRv2970c, (MTCY349.17), len: 376 aa. Probable lipN, lipase/esterase, similar to others e.g. Q9AA37|CC0771 putative esterase from Caulobacter crescentus (380 aa), FASTA scores: opt: 822, E(): 8e-46, (42.15% identity in 318 aa overlap); Q9XDR4 esterase HDE from petroleum-degrading bacterium HD-1 (317 aa), FASTA scores: opt: 738, E(): 2e-40, (48.85% identity in 262 aa overlap); O52270 lipase from Pseudomonas sp. (strain B11-1) (308 aa), FASTA scores: opt: 683, E(): 7.3e-37, (41.3% identity in 288 aa overlap); etc. Also similar to P71668 hypothetical 34.1 KDA protein from Mycobacterium tuberculosis (320 aa), FASTA scores: opt: 715, E(): 6.3e-39, (42.3% identity in 298 aa overlap). Equivalent to AAK47374 from Mycobacterium tuberculosis strain CDC1551 (309 aa) but longer 67 aa.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33245733325703-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2970c|lipN
MTKSLPGVADLRLGANHPRMWTRRVQGTVVNVGVKVLPWIPTPAKRILSAGRSVIIDGNTLDPTLQLMLSTSRIFGVDGLAVDDDIVASRAHMRAICEAMPGPQIHVDVTDLSIPGPAGEIPARHYRPSGGGATPLLVFYHGGGWTLGDLDTHDALCRLTCRDADIQVLSIDYRLAPEHPAPAAVEDAYAAFVWAHEHASDEFGALPGRVAVGGDSAGGNLSAVVCQLARDKARYEGGPTPVLQWLLYPRTDFTAQTRSMGLFGNGFLLTKRDIDWFHTQYLRDSDVDPADPRLSPLLAESLSGLAPALIAVAGFDPLRDEGESYAKALRAAGTAVDLRYLGSLTHGFLNLFQLGGGSAAGTNELISALRAHLSRV