Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved membrane or exported protein
CommentsRv2972c, (MTCY349.15), len: 237 aa. Possible conserved membrane or exported protein, equivalent (but longer 52 aa) to O69461|MLCB1243.02 hypothetical 20.5 KDA protein from Mycobacterium leprae (180 aa), FASTA scores: opt: 581, E(): 8.2e-32, (55.75% identity in 174 aa overlap). Also similar to membrane or exported proteins e.g. Q9F2P3|SCE41.16C putative lipoprotein from Streptomyces coelicolor (258 aa), FASTA scores: opt: 498, E(): 4.1e-26, (44.08% identity in 186 aa overlap); Q99QB5|SCP1.323C putative secreted protein from Streptomyces coelicolor (219 aa), FASTA scores: opt: 329, E(): 8.5e-15, (36.35% identity in 176 aa overlap); Q9ACQ1|SCP1.267 putative secreted protein from Streptomyces coelicolor (219 aa), FASTA scores: opt: 286, E(): 6.6e-12, (32.03% identity in 231 aa overlap); etc.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33270233327736-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2972c|Rv2972c
MNRRTLLWLSAIAALALVVAYQTLGSSAGRHADEFAARAGVPTVQPGADVLAGIAVLPKRIHRYDYRRSAFGHPWDDRNDAPGGHNGCDTRDDILDRDLVDKTYVSIKRCPNAVATGTLRDPYTNTTVAFQRGASVGQSVQIDHIVPLSYAWDMGAYRWPNSERMRFANDPANLLAVQGQANQDKGDSPPAQWMPPNKAFACQYAMQFIAVLRGYSLPVDQPSSDVLRQAAATCPTG