Gene Rv2972c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane or exported protein |
| Comments | Rv2972c, (MTCY349.15), len: 237 aa. Possible conserved membrane or exported protein, equivalent (but longer 52 aa) to O69461|MLCB1243.02 hypothetical 20.5 KDA protein from Mycobacterium leprae (180 aa), FASTA scores: opt: 581, E(): 8.2e-32, (55.75% identity in 174 aa overlap). Also similar to membrane or exported proteins e.g. Q9F2P3|SCE41.16C putative lipoprotein from Streptomyces coelicolor (258 aa), FASTA scores: opt: 498, E(): 4.1e-26, (44.08% identity in 186 aa overlap); Q99QB5|SCP1.323C putative secreted protein from Streptomyces coelicolor (219 aa), FASTA scores: opt: 329, E(): 8.5e-15, (36.35% identity in 176 aa overlap); Q9ACQ1|SCP1.267 putative secreted protein from Streptomyces coelicolor (219 aa), FASTA scores: opt: 286, E(): 6.6e-12, (32.03% identity in 231 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3327023 | 3327736 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2972c|Rv2972c
MNRRTLLWLSAIAALALVVAYQTLGSSAGRHADEFAARAGVPTVQPGADVLAGIAVLPKRIHRYDYRRSAFGHPWDDRNDAPGGHNGCDTRDDILDRDLVDKTYVSIKRCPNAVATGTLRDPYTNTTVAFQRGASVGQSVQIDHIVPLSYAWDMGAYRWPNSERMRFANDPANLLAVQGQANQDKGDSPPAQWMPPNKAFACQYAMQFIAVLRGYSLPVDQPSSDVLRQAAATCPTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant