Gene Rv2980
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved secreted protein |
| Comments | Rv2980, (MTCY349.07c), len: 181 aa. Possible conserved secreted protein, equivalent to Q9CBS1 possible secreted protein from Mycobacterium leprae (191 aa), FASTA scores: opt: 794, E(): 2.3e-40, (67.25% identity in 177 aa overlap). Also some weak similarity with other hypothetical proteins or secreted proteins e.g. C-terminus of Q98F98|MLL3872 MLL3872 protein from Rhizobium loti (Mesorhizobium loti) (575 aa), FASTA scores: opt: 148, E(): 0.16, (28.35% identity in 194 aa overlap); Q9L0W9|SCH22A.13C putative secreted protein from Streptomyces coelicolor (167 aa), FASTA scores: opt: 114, E(): 7.5, (40.0% identity in 80 aa overlap); etc. Equivalent to AAK47385 from Mycobacterium tuberculosis strain CDC1551 (214 aa) but shorter 33 aa. Has hydrophobic stretch near N-terminus. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3335960 | 3336505 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2980|Rv2980
VTGESDGPPRAVLIAAAALAAAVIGVILVVAANRQPPERPVVIPAVPAPQATGPGCKALLAALPQRLGEYRRAPVAEPTTAGATAWRTGPNSTPVILRCGLDRPAEFVVGSAIQVVDRVQWFQVAAQNPDEPGRSTWYTVDRPVYVALTLPSGSGPTAIQELSDVIDHTIPAVPIDPAPAR
Bibliography
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
