Gene Rv2994
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; COULB be involved in efflux system (possibly drug). |
| Product | Probable conserved integral membrane protein |
| Comments | Rv2994, (MTV012.08), len: 445 aa. Probable conserved integral membrane protein, member of major facilitator superfamily (MFS) possibly involved in transport of drug. C-terminal part highly similar to O33118|MLCB637.27c hypothetical 14.7 KDA protein (probable pseudogene product) from Mycobacterium leprae (134 aa), FASTA scores: opt: 483, E(): 2.7e-21, (60.9% identity in 138 aa overlap). Also similar to various transporters e.g. Q9I5C8|PA0811 probable MFS transporter from Pseudomonas aeruginosa (415 aa), FASTA scores: opt: 289, E(): 1.3e-09, (26.05% identity in 399 aa overlap); O30210|AF0025 cyanate transport protein from Archaeoglobus fulgidus (393 aa), FASTA scores: opt: 281, E(): 3.7e-09, (24.05% identity in 399 aa overlap); Q9RI35|SCJ12.25C putative nitrate/nitrite transporter from Streptomyces coelicolor (412 aa), FASTA scores: opt: 264, E(): 3.8e-08, (24.95% identity in 409 aa overlap); Q9A5N5|CC2412 major facilitator family transporter from Caulobacter crescentus (405 aa), FASTA scores: opt: 263, E(): 4.3e-08, (27.55% identity in 399 aa overlap); etc. First start taken; similarity to P21191|NORA_STAAU quinolone resistance protein from Staphylococcus aureus (388 aa) suggests alternative start at 7319 but then no positively charged aa before first transmembrane segment. |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3351269 | 3352606 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2994|Rv2994
MSRDPTGVGARWAIMIVSLGVTASSFLFINGVAFLIPRLENARGTPLSHAGLLASMPSWGLVVTMFAWGYLLDHVGERMVMAVGSALTAAAAYAAASVHSLLWIGVFLFLGGMAAGGCNSAGGRLVSGWFPPQQRGLAMGIRQTAQPLGIASGALVIPELAERGVHAGLMFPAVVCTLAAVASVLGIVDPPRKSRTKASEQELASPYRGSSILWRIHAASALLMMPQTVTVTFMLVWLINHHGWSVAQAGVLVTISQLLGALGRVAVGRWSDHVGSRMRPVRLIAAAAAATLFLLAAVDNEGSRYDVLLMIAISVIAVLDNGLEATAITEYAGPYWSGRALGIQNTTQRLMAAAGPPLFGSLITTAAYPTAWALCGVFPLAAVPLVPVRLLPPGLETRARRQSVRRHRWWQAVRCHAWPNGPRRPGPPGQPRRVRQGGTAITPPT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
