Gene Rv3030
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3030, (MTV012.45), len: 274 aa. Conserved protein, equivalent to O33094|MLCB637.02c|ML1713 hypothetical 30.8 KDa protein from Mycobacterium leprae (280 aa), FASTA scores: opt: 1388, E(): 5.5e-83, (78.2% identity in 280 aa overlap). N-terminus has similarity to hypothetical proteins from a number of organisms and to Q54303|EMBL:X86780|RAPM methyltransferase from Streptomyces hygroscopicus (317 aa), FASTA scores: opt: 191, E(): 3.6e-05, (35.65% identity in 101 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3389101 | 3389925 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3030|Rv3030
MCAFVPHVPRHSRGDNPPSASTASPAVLTLTGERTIPDLDIENYWFRRHQVVYQRLAPRCTARDVLEAGCGEGYGADLIACVARQVIAVDYDETAVAHVRSRYPRVEVMQANLAELPLPDASVDVVVNFQVIEHLWDQARFVRECARVLRGSGLLMVSTPNRITFSPGRDTPINPFHTRELNADELTSLLIDAGFVDVAMCGLFHGPRLRDMDARHGGSIIDAQIMRAVAGAPWPPELAADVAAVTTADFEMVAAGHDRDIDDSLDLIAIAVRP
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
