Gene Rv3037c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3037c, (MTV012.52c), len: 358 aa. Conserved hypothetical protein, similar in part to others e.g. O86799|SC6G4.36c from Streptomyces coelicolor (426 aa), FASTA scores: opt: 545, E(): 5.5e-27, (36.15% identity in 354 aa overlap); Q9UZW6|PAB0687 from Pyrococcus abyssi (386 aa), FASTA scores: opt: 262, E(): 3.5e-09, (31.0% identity in 200 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3397214 | 3398290 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3037c|Rv3037c
VRARFGDRAPWLVETTLLRRRAAGKLGELCPNVGVSQWLFTDEALQQATAAPVARHRARRLAGRVVHDATCSIGTELAALRELAVRAVGSDIDPVRLAMARHNLAALGMEADLCRADVLHPVTRDAVVVIDPARRSNGRRRFHLADYQPGLGPLLDRYRGRDVVVKCAPGIDFEEVGRLGFEGEIEVISYRGGVREACLWSAGLAGSGIRRRASILDSGEQIGDDEPDDCGVRPAGKWIVDPDGAVVRAGLVRNYGARHGLWQLDPQIAYLSGDRLPPALRGFEVLEQLAFDERRLRQVLSALDCGAAEILVRGVAIDPDALRRRLRLRGSRPLAVVITRIGAGSLSHVTAYVCRPSR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
