Gene Rv3079c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3079c, (MTCY22D7.02), len: 275 aa. Conserved protein, similar to other hypothetical mycobacterium proteins e.g. P71557|Y953_MYCTU|Rv0953c|MTCY10D7.21 possible oxidoreductase from Mycobacterium tuberculosis strain H37Rv (282 aa), FASTA scores: opt: 668, E(): 2.4e-34, (40.55% identity in 281 aa overlap); O06216|Rv2161c|MTCY270.07 from Mycobacterium tuberculosis strain H37Rv (288 aa), FASTA scores: opt: 595, E(): 8.5e-30, (40.9% identity in 274 aa overlap); O87779 from Mycobacterium paratuberculosis (166 aa), FASTA scores: opt: 464, E(): 7.2e-22, (41.55% identity in 166 aa overlap); etc. Also some similarity to other proteins e.g. Q9AH10 putative F420-dependent dehydrogenase from Rhodococcus erythropolis (295 aa), FASTA scores: opt: 401, E(): 9.6e-18, (30.2% identity in 288 aa overlap); Q9AE04|RIF17 RIF17 protein from Amycolatopsis mediterranei (356 aa), FASTA scores: opt: 298, E(): 2.8e-11, (35.0% identity in 203 aa overlap); AAK48081|MT3720 luciferase-related protein from Mycobacterium tuberculosis strain CDC1551 (395 aa), FASTA scores: opt: 223, E(): 1.4e-06, (29.4% identity in 211 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3441770 | 3442597 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3079c|Rv3079c
MQFGVLTFVTDEGIGPAELGAALEHRGFESLFLAEHTHIPVNTQSPYPGGGPIPEKYYRTLDPFVALAAAAATTQSLVLGTGIALIPERDPIVTAKEVASLDLVSQGRFRFGVGVGWLREEVANHGVDPAVRGRVIDERLRAIIEIWTQEQAEFHGTYVDFDPIYCWPKPVTKPYPPLYVGGGPANFPRIARLNAGWIAISPSPQRLSGPLQRLRAMAGGDVPVTVCQWGEAAAKDLEGYRHLGVERVLLELPTEPRDPTLRYLDKLQAELARLA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
