Gene Rv3111 (moaC)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the biosynthesis of molybdopterin. |
| Product | Probable molybdenum cofactor biosynthesis protein C MoaC1 |
| Comments | Rv3111, (MTCY164.21), len: 170 aa. Probable moaC1, molybdopterin cofactor biosynthesis protein, highly similar to others e.g. Q9HX95|MOAC|PA3918 from Pseudomonas aeruginosa (160 aa), FASTA scores: opt: 576, E(): 2.2e-29, (62.1% identity in 153 aa overlap); Q9ZFA6|MOAC from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) (159 aa), FASTA scores: opt: 541, E(): 3.4e-27, (59.85% identity in 157 aa overlap); BAB48171|MLR0616 from Rhizobium loti (Mesorhizobium loti) (160 aa), FASTA scores: opt: 531, E(): 1.5e-26, (58.75% identity in 160 aa overlap); P30747|MOAC_ECOLI|CHLA3|B0783 from Escherichia coli strain K12 (160 aa), FASTA scores: opt: 527, E(): 2.6e-26, (58.5% identity in 159 aa overlap); etc. Also highly similar to O53376|MOAC3|Rv3324c|MTV016.24c putative molybdenum cofactor biosynthesis protein C 3 from Mycobacterium tuberculosis (177 aa), FASTA scores: opt: 738, E(): 1.7e-39, (71.5% identity in 165 aa overlap); AAK47767|MT3425 molybdopterin cofactor biosynthesis protein C from Mycobacterium tuberculosis strain CDC1551 (184 aa), FASTA scores: opt: 734, E(): 3.1e-39, (71.8% identity in 163 aa overlap); and Rv0864|MOAC2|MTV043.57 putative molybdenum cofactor biosynthesis protein C 2 (167 aa). Note that previously known as moaC. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3479171 | 3479683 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3111|moaC1
MIDHALALTHIDERGAARMVDVSEKPVTLRVAKASGLVIMKPSTLRMISDGAAAKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDAVSVTITPCEPDRVKILATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEISQIVLQEKSGGRSGVYRRSASDLACQSR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Mendoza Lopez P et al. [2010]. Characterization of the transcriptional regulator Rv3124 of Mycobacterium tuberculosis identifies it as a positive regulator of molybdopterin biosynthesis and defines the functional consequences of a non-synonymous SNP in the Mycobacterium bovis BCG orthologue. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
