Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the biosynthesis of molybdopterin.
ProductProbable molybdenum cofactor biosynthesis protein C MoaC1
CommentsRv3111, (MTCY164.21), len: 170 aa. Probable moaC1, molybdopterin cofactor biosynthesis protein, highly similar to others e.g. Q9HX95|MOAC|PA3918 from Pseudomonas aeruginosa (160 aa), FASTA scores: opt: 576, E(): 2.2e-29, (62.1% identity in 153 aa overlap); Q9ZFA6|MOAC from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) (159 aa), FASTA scores: opt: 541, E(): 3.4e-27, (59.85% identity in 157 aa overlap); BAB48171|MLR0616 from Rhizobium loti (Mesorhizobium loti) (160 aa), FASTA scores: opt: 531, E(): 1.5e-26, (58.75% identity in 160 aa overlap); P30747|MOAC_ECOLI|CHLA3|B0783 from Escherichia coli strain K12 (160 aa), FASTA scores: opt: 527, E(): 2.6e-26, (58.5% identity in 159 aa overlap); etc. Also highly similar to O53376|MOAC3|Rv3324c|MTV016.24c putative molybdenum cofactor biosynthesis protein C 3 from Mycobacterium tuberculosis (177 aa), FASTA scores: opt: 738, E(): 1.7e-39, (71.5% identity in 165 aa overlap); AAK47767|MT3425 molybdopterin cofactor biosynthesis protein C from Mycobacterium tuberculosis strain CDC1551 (184 aa), FASTA scores: opt: 734, E(): 3.1e-39, (71.8% identity in 163 aa overlap); and Rv0864|MOAC2|MTV043.57 putative molybdenum cofactor biosynthesis protein C 2 (167 aa). Note that previously known as moaC. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34791713479683+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3111|moaC1
MIDHALALTHIDERGAARMVDVSEKPVTLRVAKASGLVIMKPSTLRMISDGAAAKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDAVSVTITPCEPDRVKILATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEISQIVLQEKSGGRSGVYRRSASDLACQSR