Gene Rv3119 (moaE)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly a molybdenum biosynthesis cofactor. Conversion of molybdopterin precursor Z into molybdopterin requires transfer of two sulfur atoms to precursor Z (to generate the dithiolene group). This is catalyzed by the converting factor composed of a small and large subunit. |
| Product | Probable molybdenum cofactor biosynthesis protein E MoaE1 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor, subunit 2) |
| Comments | Rv3119, (MTCY164.29), len: 147 aa. Probable moaE1, molybdopterin converting factor E (molybdopterin converting factor (subunit 2)), highly similar to others e.g. O31705|MOAE from Bacillus subtilis (157 aa), FASTA scores: opt: 390, E(): 8.6e-19, (43.95% identity in 132 aa overlap); Q9K8I7|MOAE|BH3019 from Bacillus halodurans (156 aa), FASTA scores: opt: 369, E(): 2e-17, (42.4% identity in 132 aa overlap); P30749|MOAE_ECOLI|CHLA5|B0785 from Escherichia coli strain K12 (149 aa), FASTA scores: opt: 312, E(): 1.1e-13, (38.45% identity in 130 aa overlap); etc. Also highly similar (but shorter 74 aa) to O53375|GPHA|Rv3323c|MTV016.23c MOAD-MOAE fusion protein from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 733, E(): 3.9e-41, (76.2% identity in 143 aa overlap); and highly similar to O53878|MOAE2|Rv0866|MTV043.59 putative molybdopterin synthase large subunit from Mycobacterium tuberculosis (141 aa), FASTA scores: opt: 321, E(): 2.6e-14, (40.9% identity in 132 aa overlap). Note that previously known as moaE. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3485132 | 3485575 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3119|moaE1
MANVVAEGAYPYCRLTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEAYPPMVIRTLMSIIGRCEDKAEGVRVAVAHRTGELQIGDAAVVIGASAPHRAEAFDAARMCIELLKQEVPIWKKEFSSTGAEWVGDRP
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant