Gene Rv3186
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the transposition of the insertion sequence IS6110. |
| Product | Probable transposase for insertion sequence element IS6110 (fragment) |
| Comments | Rv3186, (MTV014.30), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase subunits. The transposase described here may be made by a frame shifting mechanism during translation that fuses Rv3186 and Rv3187, the sequence UUUUAAAG (directly upstream of Rv3187) maybe responsible for such a frameshifting event (see McAdam et al., 1990). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3552764 | 3553090 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3186|Rv3186
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
Bibliography
- Thierry D et al. [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. Sequence
- McAdam RA, Hermans PW, van Soolingen D, Zainuddin ZF, Catty D, van Embden JD and Dale JW [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence belonging to the IS3 family. Sequence
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
