Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the transposition of an insertion sequence.
ProductProbable transposase
CommentsRv3191c, (MTV014.35c), len: 344 aa. Probable transposase, similar to many especially Q9K2N8 putative transposase from Pseudomonas aeruginosa (338 aa), FASTA scores: opt: 837, E(): 1.3e-43, (42.55% identity in 336 aa overlap); Q9RBF4 insertion sequence IS1088 from Alcaligenes eutrophus (Ralstonia eutropha) (342 aa), FASTA scores: opt: 823, E(): 9.2e-43, (43.05% identity in 337 aa overlap); and Q51379 putative transposase from Pseudomonas alcaligenes (338 aa), FASTA scores: opt: 818, E(): 1.8e-42, (42.35% identity in 333 aa overlap). Contains probable helix-turn-helix motif from aa 25 to 46 (Score 1968, +5.89 SD). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryInsertion seqs and phages
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35573113558345-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv3191c|3557311-3558345|-|Rv3191c|downstream:0|upstream:0
gtgcgccaaattagtagtcgctatctgtccgaggaggagcggatcaacatcgccgatctgcgccgctcgggcctaagtatccgcaagatcgccgaccagctcggacgggcaccctcgacggtgtcgcgggagctacgccgcaacagtcgccgcgatggccagtaccggccgttcgaagcgcatcgctgggcggttcaacgccgagtccgccgtcaccggcgtcggatcgacaaaaaccccgacctttgtgagctgatcgccgagctgctggcccagcggtggagcccgcaacagatcgcccggcatctgcgacggaaataccccgatgaccggtcgatgtggttgtgccacgaaagcatctatcaggccgtctatcagcctcaatcacgattgatccggccgccgcaggtcaagtcgccacaccgtggccctctgcgcacgggacgaactcatcgccgcgcccatctgcgtcctggccgtcgccgcccgcgcttcgcccagccgatgttgtcgattcaccagcggccgttcgatcccgccgaccgctccgagcctggccactgggaaggagatctcatcgttggtaagaaccagggctcggcgattggcaccctcgtcgagcgacagacacgtctgattcggctgctgcacctgccgacccacgacgcttactgcctgcgcatcgcgatcaccgagaccatgagcgacttgccggtgacgctggtccggtccatcacgtgggatcagggcatcgaaatggcccggcacatcgacatcaccgccgacctgggcgcgccggtctacttttgcgactcccgctcaccgtggcagcgagccagcaacgagaactccaacggtctgctacggcaatacttcccaaagggcaccagcctcagcacctacacgcccgaccatctgcgggctgtcgaatacgagatcaataaccgaccccgccaagtcctcgggcaccgcagtcccgctgaacttttcaccgcgctgctaacctcaccagaccatcaattgttgcgacgttga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3191c|Rv3191c
VRQISSRYLSEEERINIADLRRSGLSIRKIADQLGRAPSTVSRELRRNSRRDGQYRPFEAHRWAVQRRVRRHRRRIDKNPDLCELIAELLAQRWSPQQIARHLRRKYPDDRSMWLCHESIYQAVYQPQSRLIRPPQVKSPHRGPLRTGRTHRRAHLRPGRRRPRFAQPMLSIHQRPFDPADRSEPGHWEGDLIVGKNQGSAIGTLVERQTRLIRLLHLPTHDAYCLRIAITETMSDLPVTLVRSITWDQGIEMARHIDITADLGAPVYFCDSRSPWQRASNENSNGLLRQYFPKGTSLSTYTPDHLRAVEYEINNRPRQVLGHRSPAELFTALLTSPDHQLLRR