Gene Rv3195
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3195, (MTV014.39), len: 472 aa. Hypothetical protein, equivalent to Q49746|ML0642|B1937_C3_231 hypothetical 50.3 KDA protein from Mycobacterium leprae (479 aa), FASTA scores: opt: 2503, E(): 1e-138, (79.35% identity in 475 aa overlap). Similar in part to Q9FCI9|2SC3B6.23c conserved hypothetical protein from Streptomyces coelicolor (487 aa), FASTA scores: opt: 1382, E(): 2.7e-73, (46.4% identity in 489 aa overlap); Q9X8I7|SCE9.14 hypothetical 41.2 KDA protein from Streptomyces coelicolor (375 aa), FASTA scores: opt: 319, E(): 2.4e-11, (25.6% identity in 383 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3564364 | 3565782 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3195|Rv3195
VSTGEVMGDLPFGFSSGDDPPEDPSGRDKRGKDGADSGSGANPLGAFGIGGEFNMADLGQIFTRLGEMFGGVGTAMAAGKTSGPVNYDLARQVASSSIGFIAPIPAATNSAIADAVHLADTWLDGATSLPAGATKAVGWSPTDWVDNTLATWKRLCDPMAQQISTVWASSLPEEAKSMAGPLLSIMSQMGGIAFGSQLGQALGRLSREVLTSTDIGLPLGPKGVAAILPGAVESFAAGLEQPRSEILTFLATREAAHHRLFSHVPWLASQLLGAVEAYAMGMKIDMTGIEELARDINPTSLADPAAMEQLLSQGVFEPKATPAQTQALERLETLLALIEGWVQTVVTAALGERIPGEAALSETLRRRRASGGPAEQTFATLVGLELRPRKLREAGALWERLTRAVGMDARDAVWQHPDLLPATDDLDDPAAFIDRVIGGDTSGIDEAIAELERDQQARGADDSGHDGGPVDN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
