Gene Rv3198A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible glutaredoxin protein |
| Comments | Rv3198A, len: 84 aa. Possible glutaredoxin protein , highly similar to Q9FCK1|2SC3B6.11c putative glutaredoxin-like protein from Streptomyces coelicolor (80 aa), FASTA scores: opt: 293, E(): 2.2e-14, (55.15% identity in 78 aa overlap); and Q9RSN9|DR2085 putative glutaredoxin from Deinococcus radiodurans (81 aa), FASTA scores: opt: 198, E(): 1.2e-07, (53.55% identity in 56 aa overlap). Also similar to several hypothetical bacterial proteins e.g. Q9X8C2|SCE36.09 hypothetical 13.0 KDA protein from Streptomyces coelicolor (114 aa), FASTA scores: opt: 181, E(): 2.6e-06, (44.45% identity in 72 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3571335 | 3571589 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3198A|Rv3198A
MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAG
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
