Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3218, (MTCY07D11.08c), len: 321 aa. Conserved protein, similar to several hypothetical bacterial proteins e.g. Q9F3M0|2SC7G11.03c from Streptomyces coelicolor (322 aa), FASTA scores: opt: 694, E(): 4.2e-35, (39.95% identity in 328 aa overlap); Q9A0J4|SPY0752 from Streptomyces pyogenes (340 aa), FASTA scores: opt: 187, E(): 0.00033, (30.5% identity in 141 aa overlap); O31502|YERQ from Bacillus subtilis (303 aa), FASTA scores: opt: 184, E(): 0.00045, (34.15% identity in 126 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35944683595433+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3218|Rv3218
MRAVLIVNPTATATTPAGRDLLAHALESRLQLTVEHTNHRGHGTELGQAAVADGVDLVVVHGGDGTVSAVVNGMLGRPGTTPVRPVPAVAVVPGGSANVLARALGISADPIAATNQLIQLLDDYGRHQQWRRIGLIDCGERWAVFNAGMGVDAEVVAAVEAERDKGGKVTAWRYIRAAVRAVLACTRREPALTLQLPNRDPITGVHFVFVSNSSPWTYANNRPVWTNPDCRFESGLGVFATTSMKVVPTLRVVRQMFAKQPKFEFNHVINNDDVACLRVTSMGPPIASQFDGDYLGVRETMTFRAVPDALAVVAPPARKRI