Gene Rv3306c (amiB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in cellular metabolism, active on carbon aliphatic amides and/or on many aromatic amides [catalytic activity: a monocarboxylic acid amide + H(2)O = a monocarboxylate + NH(3)]. |
| Product | Probable amidohydrolase AmiB1 (aminohydrolase) |
| Comments | Rv3306c, (MTV016.05c), len: 394 aa. Probable amiB1, aminohydrolase, similar to several belonging to peptidase family M40 (and to hypothetical proteins) e.g. P54983|AMHX_BACSU amidohydrolase AMHX from Bacillus subtilis (389 aa), FASTA scores: opt: 286, E(): 9.9e-10, (26.6% identity in 351 aa overlap); P76052|ABGB_ECOLI Aminobenzoyl-glutamate utilizatio from Escherichia coli (481 aa), FASTA scores: opt: 383, E(): 2.1e-15, (30.5% identity in 328 aa overlap); P44765|YDAJ_HAEIN hypothetical protein HI0584 from Haemophilus influenzae (423 aa), FASTA scores: opt: 297, E(): 2.4e-10, (29.6% identity in 274 aa overlap). Note that previously known as amiB. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3692805 | 3693989 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3306c|amiB1
MPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVAERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIAASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVAVMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQVAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRELQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLGREPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVASAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
