Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in molybdenum cofactor biosynthesis.
ProductProbable MoaD-MoaE fusion protein MoaX
CommentsRv3323c, (MTV016.23c), len: 221 aa. Probable moaX, MoaD-MoaE fusion protein, similar (whole or partial) to several MoaD and MoaE proteins e.g. Q9RR88|DR2607 molybdenum cofactor biosynthesis protein D/E from Deinococcus radiodurans (229 aa), FASTA scores: opt: 407, E(): 1.8e-18, (32.75% identity in 223 aa overlap); Q9K8I7|MOAE|BH3019 molybdopterin converting factor (subunit 2) from Bacillus halodurans (156 aa), FASTA scores: opt: 375, E(): 1.3e-16, (41.65% identity in 132 aa overlap); O31705|MOAE molybdopterin converting factor (subunit 2) from Bacillus subtilis (157 aa), FASTA scores: opt: 368, E(): 3.6e-16, (41.65% identity in 132 aa overlap); etc. C-terminus highly similar to O05795|MOAE_MYCTU|Rv3119|MT3201|MTCY164.29|MOAE1 putative molybdenum cofactor biosynthesis protein E from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 733, E(): 5.4e-39, (76.2% identity in 143 aa overlap); and N-terminus highly similar to O05789|MOAD1|Rv3112|MTCY164.22 putative molybdenum cofactor biosynthesis protein D from Mycobacterium tuberculosis (83 aa), FASTA scores: opt: 333, E(): 3.2e-14, (65.05% identity in 83 aa overlap).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37090493709714-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3323c|moaX
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP