Gene Rv3323c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in molybdenum cofactor biosynthesis. |
| Product | Probable MoaD-MoaE fusion protein MoaX |
| Comments | Rv3323c, (MTV016.23c), len: 221 aa. Probable moaX, MoaD-MoaE fusion protein, similar (whole or partial) to several MoaD and MoaE proteins e.g. Q9RR88|DR2607 molybdenum cofactor biosynthesis protein D/E from Deinococcus radiodurans (229 aa), FASTA scores: opt: 407, E(): 1.8e-18, (32.75% identity in 223 aa overlap); Q9K8I7|MOAE|BH3019 molybdopterin converting factor (subunit 2) from Bacillus halodurans (156 aa), FASTA scores: opt: 375, E(): 1.3e-16, (41.65% identity in 132 aa overlap); O31705|MOAE molybdopterin converting factor (subunit 2) from Bacillus subtilis (157 aa), FASTA scores: opt: 368, E(): 3.6e-16, (41.65% identity in 132 aa overlap); etc. C-terminus highly similar to O05795|MOAE_MYCTU|Rv3119|MT3201|MTCY164.29|MOAE1 putative molybdenum cofactor biosynthesis protein E from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 733, E(): 5.4e-39, (76.2% identity in 143 aa overlap); and N-terminus highly similar to O05789|MOAD1|Rv3112|MTCY164.22 putative molybdenum cofactor biosynthesis protein D from Mycobacterium tuberculosis (83 aa), FASTA scores: opt: 333, E(): 3.2e-14, (65.05% identity in 83 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3709049 | 3709714 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3323c|moaX
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
