Gene Rv3324c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in the biosynthesis of molybdopterin. |
| Product | Probable molybdenum cofactor biosynthesis protein C 3 MoaC3 |
| Comments | Rv3324c, (MTV016.24c), len: 177 aa. Probable moaC3, molybdopterin cofactor biosynthesis protein, highly similar to others e.g. Q9HX95|MOAC|PA3918 from Pseudomonas aeruginosa (160 aa), FASTA scores: opt: 567, E(): 7.5e-30, (58.35% identity in 156 aa overlap); Q9RKA8|MOAC from Streptomyces coelicolor (170 aa), FASTA scores: opt: 553, E(): 6.3e-29, (58.25% identity in 158 aa overlap); P30747|MOAC_ECOLI|CHLA3|B0783 from Escherichia coli strain K12 (160 aa), FASTA scores: opt: 516, E(): 1.5e-26, (55.95% identity in 159 aa overlap); etc. Also highly similar to O05788|MOAC1|Rv3111|MTCY164.21 putative molybdenum cofactor biosynthesis protein C from Mycobacterium tuberculosis (170 aa), FASTA scores: opt: 734, E(): 1.3e-40, (71.8% identity in 163 aa overlap); and Rv0864|MOAC2|MTV043.57 putative molybdenum cofactor biosynthesis protein (167 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3709715 | 3710248 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3324c|moaC3
VNDHDGVLTHLDEQGAARMVDVSAKAVTLRRARASGAVLMKPSTLDMICHGTAAKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLEPQGADRLSIAATVTTVARTGVEMEALTAVTVTALTVYDMCKAVDRAMTITDIRLDEKSGGRSGHYRRHDADVKPSDGGSTEDGC
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
