Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3361c, (MTV004.18c), len: 183 aa. Conserved protein, with some similarity to various proteins e.g. P74221|YB52_SYNY3|SLR1152 hypothetical 36.2 KDA protein SLR (contains 5 pentapeptide repeat domains) from Synechocystis sp. strain PCC 6803 (331 aa), FASTA scores: opt: 252, E(): 3.9e-10, (30.55% identity in 167 aa overlap); Q9SE95 FH protein interacting protein FIP2 from Arabidopsis thaliana (Mouse-ear cress) (298 aa), FASTA scores: opt: 207, E(): 4.4e-07, (30.35% identity in 168 aa overlap); Q9A735|CC1891 pentapeptide repeat family protein from Caulobacter crescentus (250 aa), FASTA scores: opt: 181, E(): 2.3e-05, (24.05% identity in 187 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37730163773567-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3361c|Rv3361c
LQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG