Gene Rv3361c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3361c, (MTV004.18c), len: 183 aa. Conserved protein, with some similarity to various proteins e.g. P74221|YB52_SYNY3|SLR1152 hypothetical 36.2 KDA protein SLR (contains 5 pentapeptide repeat domains) from Synechocystis sp. strain PCC 6803 (331 aa), FASTA scores: opt: 252, E(): 3.9e-10, (30.55% identity in 167 aa overlap); Q9SE95 FH protein interacting protein FIP2 from Arabidopsis thaliana (Mouse-ear cress) (298 aa), FASTA scores: opt: 207, E(): 4.4e-07, (30.35% identity in 168 aa overlap); Q9A735|CC1891 pentapeptide repeat family protein from Caulobacter crescentus (250 aa), FASTA scores: opt: 181, E(): 2.3e-05, (24.05% identity in 187 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3773016 | 3773567 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3361c|Rv3361c
LQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Hegde SS et al. [2005]. A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
