Gene Rv3381c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the transposition of the insertion sequence IS6110. |
| Product | Probable transposase for insertion sequence element IS6110 (fragment) |
| Comments | Rv3381c, (MTV004.39c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase subunits. The transposase described here may be made by a frame shifting mechanism during translation that fuses Rv3380c and Rv3381c, the sequence UUUUAAAG (directly upstream of Rv3380c) maybe responsible for such a frameshifting event (see McAdam et al., 1990). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3796035 | 3796361 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3381c|Rv3381c
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR
Bibliography
- Thierry D et al. [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. Sequence
- McAdam RA, Hermans PW, van Soolingen D, Zainuddin ZF, Catty D, van Embden JD and Dale JW [1990]. Characterization of a Mycobacterium tuberculosis insertion sequence belonging to the IS3 family. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
