Gene Rv3437
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv3437, (MTCY77.09), len: 158 aa. Questionable ORF. Possible conserved transmenbrane protein, C-terminus similar to N-terminal part of O06345|Rv3482c|MTCY13E12.35c hypothetical 28.5 KDA protein from Mycobacterium tuberculosis (260 aa), FASTA scores: opt: 140, E(): 0.1, (58.8% identity in 34 aa overlap); and Q9XAN5|SC4C6.05c putative membrane protein from Streptomyces (347 aa), coelicolor FASTA scores: opt: 112, E(): 6.8, (50.0% identity in 32 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3856911 | 3857387 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3437|Rv3437
MVGRAVPSPNRRYRRVWPPRTKGQHLSNPYAQHQLKLIRHTGALILWQQRTYVVSGTREQCEAAYKSAQTYNLLVGWWSLVSLLAMNWIALISNFNAIRRVRAAADGASVPHGPHAIAHPAVPRGPIPAGWYPDPSGAGLRYWDGATWTHWTHPPRHR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant