Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved transmembrane protein
CommentsRv3437, (MTCY77.09), len: 158 aa. Questionable ORF. Possible conserved transmenbrane protein, C-terminus similar to N-terminal part of O06345|Rv3482c|MTCY13E12.35c hypothetical 28.5 KDA protein from Mycobacterium tuberculosis (260 aa), FASTA scores: opt: 140, E(): 0.1, (58.8% identity in 34 aa overlap); and Q9XAN5|SC4C6.05c putative membrane protein from Streptomyces (347 aa), coelicolor FASTA scores: opt: 112, E(): 6.8, (50.0% identity in 32 aa overlap).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38569113857387+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3437|Rv3437
MVGRAVPSPNRRYRRVWPPRTKGQHLSNPYAQHQLKLIRHTGALILWQQRTYVVSGTREQCEAAYKSAQTYNLLVGWWSLVSLLAMNWIALISNFNAIRRVRAAADGASVPHGPHAIAHPAVPRGPIPAGWYPDPSGAGLRYWDGATWTHWTHPPRHR