Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3438, (MTCY77.10), len: 280 aa. Conserved protein, equivalent to Q9CCV6|ML0370 hypothetical protein from Mycobacterium leprae (289 aa), FASTA scores: opt: 1491, E(): 9.2e-81, (79.85% identity in 283 aa overlap); and highly similar (but shorter 41 aa) to Q49872|B229_F1_20 hypothetical 34.0 KDA protein from Mycobacterium leprae (324 aa), FASTA scores: opt: 1491, E(): 1e-80, (79.85% identity in 283 aa overlap). Shows some similarity to Q9KIU3|LIPA lipase from plasmid pAH114 uncultured bacterium (281 aa), FASTA scores: opt: 168, E(): 0.0081, (29.3% identity in 140 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38573973858239+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3438|Rv3438
VPRIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEAGLHLPGVAFGHDWLTGTSRYSGLLEHLASWGIVAAAPDSERGLAPSVLNLAFDLGVALDIVAGVRLGPGKISVHPAKLGLVGHGFGGSAAVFAAAGLTGTHVKSVAAIFPTVTNPAAEQPAATLDVPGLILTAPGDPKTLTSNALGLSRAWDKATLRIVSKARAGGLVEGRRLTKVLGLPGPHRRTQRSVRALLTGYLLYTLGGDKTYRRFADPDLQLPKTDPIDPEAPPITPGEKIVTLLK