Gene Rv3473c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Supposedly involved in detoxification reactions. |
| Product | Possible peroxidase BpoA (non-haem peroxidase) |
| Comments | Rv3473c, (MTCY13E12.26c), len: 261 aa. Possible bpoA, peroxidase (non-haem peroxidase), similar to various enzymes or hypothetical unknown proteins e.g. O85849 hypothetical 26.2 KDA protein from Sphingomonas aromaticivorans (247 aa), FASTA scores: opt: 684, E(): 4.9e-34, (43.8% identity in 242 aa overlap); AAK45412|MT1155 hydrolase, alpha/beta hydrolase fold family from Mycobacterium tuberculosis strain CDC1551 (311 aa), FASTA scores: opt: 675, E(): 2e-33, (39.45% identity in 256 aa overlap); Q9K3V0|SCD10.27 putative hydrolase from Streptomyces coelicolor (352 aa), FASTA scores: opt: 248, E(): 9.7e-08, (26.05% identity in 261 aa overlap); P29715|BPA2_STRAU|BPOA2 non-haem bromoperoxidase (bromide peroxidase) (277 aa), FASTA scores: opt: 237, E(): 3.6e-07, (29.45% identity in 265 aa overlap); O31168|PRXC_STRAU|CPO|CPOT non-heme chloroperoxidase (278 aa), FASTA scores: opt: 236, E(): 4.2e-07, (29.45% identity in 265 aa overlap); AAK62388|T5L19.180 lipase-like protein from Arabidopsis thaliana (Mouse-ear cress) (350 aa), FASTA scores: opt: 236, E(): 5.1e-07, (26.65% identity in 274 aa overlap); etc. Also similar to O06575|BPOB|Rv1123c|MTCY22G8.12c hypothetical 32.5 KDA protein from Mycobacterium tuberculosis (302 aa), FASTA scores: opt: 675, E(): 2e-33, (39.45% identity in 256 aa overlap). Equivalent to AAK47936 from Mycobacterium tuberculosis strain CDC1551 (294 aa) but shorter 33 aa. May have been inactivated or truncated by neighbouring IS6110. |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3889948 | 3890733 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3473c|bpoA
VVFLHGGGQTRRSWGRAAAAVAERGWQAVTIDLRGHGESDWSSEGDYRLVSFAGDIQEVLRNLPGQPALVGASLGGFAAMLLAGELSPGIASAVVLVDIVPNMDLAGASRIHAFMAERVESGFGSLDEVADVIANYNPHRPRPSDPDGLVANLRRRGDRWYWHWDPQFIGGIAAFPPVEVTDVDRMNAAVATILRDEVPVLLVRGQVSDIVRQESADQFLSRFPQVEFTDVRGAGHMVAGDRNDAFAGAVLDFLARHVGVR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant