Gene Rv3476c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of dicarboxylic acid across the membrane. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable dicarboxylic acid transport integral membrane protein KgtP (dicarboxylate transporter) |
| Comments | Rv3476c, (MTCY13E12.29c), len: 449 aa. Probable kgtP, dicarboxylate-transport integral membrane protein, possibly member of major facilitator superfamily (MFS), highly similar to others e.g. Q9HT43|PA5530 from Pseudomonas aeruginosa (435 aa), FASTA scores: opt: 1209, E(): 2.3e-68, (47.05% identity in 425 aa overlap); Q9I6Q9|PCAT|PA0229 from Pseudomonas aeruginosa (432 aa), FASTA scores: opt: 1131, E(): 1.8e-63, (40.4% identity in 438 aa overlap); Q9WWZ2 from Pseudomonas putida (429 aa), FASTA scores: opt: 1090, E(): 6.5e-61, (41.2% identity in 425 aa overlap); P17448|KGTP_ECOLI|WITA|B2587 from Escherichia coli strain K12 (432 aa), FASTA scores: opt: 1083, E(): 1.8e-60, (40.05% identity in 422 aa overlap); etc. Also similar to O05301|MTCI364.12|Rv1200 hypothetical 44.6 KDA protein from Mycobacterium tuberculosis (425 aa), FASTA scores: E(): 5.2e-25, (28.5% identity in 382 aa overlap). Contains sugar transport protein signatures 1 and 2 (PS00216, PS00217). Belongs to the sugar transporter family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3892371 | 3893720 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3476c|kgtP
MTVSIAPPSRPSQAETRRAIWNTIRGSSGNLVEWYDVYVYTVFATYFEDQFFDRADRNSTVYVYAIFAVTFVTRPVGSWFLGRFADRRGRRAALTFSVSLMAACSLIVALVPSRSSIGVAAPILLILCRLVQGFATGGEYGTSATYMSEAATRERRGYFSSFQYVTLVGGHVLAQFTLLVILAVFTREQVHEFGWRIGFAVGGGAAIVVFWLRRTMDESLSQERLTAIKAGRDHDSGSLRELATHYWKPLLLCFLVTLGGTVAFYTYSVNAPAIVKSVYGSQAMTATWINLVGLILLMMLQPIGGMISDKIGRKPLLLWFGVGGLIYTYVLVTYLPETRSPTMSFLLVAVGYVILTGYCSINALVKSELFPAHVRALGVGVGYALANSVFGGTAPLIYQALKERDQVPMFIAYVTACIAVSLIVYVFFIKNKADTYLDREQGFAFYGHA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant