Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in active transport of dicarboxylic acid across the membrane. Responsible for the translocation of the substrate across the membrane.
ProductProbable dicarboxylic acid transport integral membrane protein KgtP (dicarboxylate transporter)
CommentsRv3476c, (MTCY13E12.29c), len: 449 aa. Probable kgtP, dicarboxylate-transport integral membrane protein, possibly member of major facilitator superfamily (MFS), highly similar to others e.g. Q9HT43|PA5530 from Pseudomonas aeruginosa (435 aa), FASTA scores: opt: 1209, E(): 2.3e-68, (47.05% identity in 425 aa overlap); Q9I6Q9|PCAT|PA0229 from Pseudomonas aeruginosa (432 aa), FASTA scores: opt: 1131, E(): 1.8e-63, (40.4% identity in 438 aa overlap); Q9WWZ2 from Pseudomonas putida (429 aa), FASTA scores: opt: 1090, E(): 6.5e-61, (41.2% identity in 425 aa overlap); P17448|KGTP_ECOLI|WITA|B2587 from Escherichia coli strain K12 (432 aa), FASTA scores: opt: 1083, E(): 1.8e-60, (40.05% identity in 422 aa overlap); etc. Also similar to O05301|MTCI364.12|Rv1200 hypothetical 44.6 KDA protein from Mycobacterium tuberculosis (425 aa), FASTA scores: E(): 5.2e-25, (28.5% identity in 382 aa overlap). Contains sugar transport protein signatures 1 and 2 (PS00216, PS00217). Belongs to the sugar transporter family.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38923713893720-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3476c|kgtP
MTVSIAPPSRPSQAETRRAIWNTIRGSSGNLVEWYDVYVYTVFATYFEDQFFDRADRNSTVYVYAIFAVTFVTRPVGSWFLGRFADRRGRRAALTFSVSLMAACSLIVALVPSRSSIGVAAPILLILCRLVQGFATGGEYGTSATYMSEAATRERRGYFSSFQYVTLVGGHVLAQFTLLVILAVFTREQVHEFGWRIGFAVGGGAAIVVFWLRRTMDESLSQERLTAIKAGRDHDSGSLRELATHYWKPLLLCFLVTLGGTVAFYTYSVNAPAIVKSVYGSQAMTATWINLVGLILLMMLQPIGGMISDKIGRKPLLLWFGVGGLIYTYVLVTYLPETRSPTMSFLLVAVGYVILTGYCSINALVKSELFPAHVRALGVGVGYALANSVFGGTAPLIYQALKERDQVPMFIAYVTACIAVSLIVYVFFIKNKADTYLDREQGFAFYGHA