Gene Rv3494c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but thought to be involved in host cell invasion. Predicted to be involved in lipid catabolism. |
| Product | Mce-family protein Mce4F |
| Comments | Rv3494c, (MTV023.01c), len: 564 aa. Mce4F; belongs to 24-membered Mycobacterium tuberculosis Mce protein family (see citations below), similar to Mycobacterium tuberculosis proteins O07418|Rv0174|MTCI28.14|mce1F (515 aa); O07784|Rv0594|MTCY19H5.28c|mce2F (516 aa); and O53972|Rv1971|MTV051.09|mce3F (437 aa). Also similar to others e.g. Q9CD09|MCE1F|ML2594 putative secreted protein from Mycobacterium leprae (516 aa), FASTA scores: opt: 1040, E(): 3.6e-31, (35.9% identity in 529 aa overlap); Q9F361|SC8A2.02c putative secreted protein from Streptomyces coelicolor (433 aa), FASTA scores: opt: 570, E(): 3.7e-14, (30.8% identity in 458 aa overlap); etc. Has hydrophobic stretch, possibly a signal peptide at the N-terminus. Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3911675 | 3913369 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3494c|mce4F
MIDRLAKIQLSIFAVITVITLSVMAIFYLRLPATFGIGTYGVSADFVAGGGLYKNANVTYRGVAVGRVESVGLNPNGVTAHMRLNSGTAIPSNVTATVRSVSAIGEQYIDLVPPENPSSTKLRNGFRIQRQNTRIGQDVADLLRQAETLLGSLGDTRLRELLHEAFIATNGAGPELARLIESARLLVDEANANYPQVSQLIDQAGPFLQAQIRAGGDIKSLADGLARFTWQLRAADPRLRDTLADAPDAIDEANTAFSGIRPSFPALAASLANLGRVGVIYHKSIEQLLVVFPALFAAIITSAGGVPQDEGAKLDFKIDLHDPPPCMTGFLPPPLVRSPADESVREIPRDMYCKTAQNDPSTVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGTNPWRGPPIPYGTEVTDGRNILPPNKFPYIPPGADPDPGVPIVGPPPPGQVAGPGPAPHQPAQPAPPPNDNGPPPPFTSWMPPGYPPEPPQVPYPATIPPPPPPEGTGPPPGPAPGPQPQASGPAYTIYDQLSGAFADPAGGTGIFAPGMTGASSAENWVDLMRDPRQL
Bibliography
- Arruda S, Bomfim G, Knights R, Huima-Byron T and Riley LW [1993]. Cloning of an M. tuberculosis DNA fragment associated with entry and survival inside cells. Sequence
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Haile Y et al. [2002]. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Homolog Function
- Panigada M et al. [2002]. Identification of a promiscuous T-cell epitope in Mycobacterium tuberculosis Mce proteins. Gene
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
