Gene Rv3506
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but supposed involvement in lipid degradation. |
| Product | Fatty-acid-CoA synthetase FadD17 (fatty-acid-CoA synthase) (fatty-acid-CoA ligase) |
| Comments | Rv3506, (MTV023.13), len: 502 aa. fadD17, fatty-acid-CoA synthetase (ligase), similar to P72007|FADD1|RV1750c|MTCY28.13c|MTCY04C12.34 from Mycobacterium tuberculosis (532 aa), FASTA scores: opt: 666, E(): 9.8e-32, (52.05% identity in 488 aa overlap). Also similar to various ligases/synthetases e.g. Q9EY88|FCS feruloyl-CoA synthetase from Amycolatopsis sp. HR167 (491 aa), FASTA scores: opt: 490, E(): 2.1e-21, (30.3% identity in 462 aa overlap); BAB33463|ECS0040 (alias AAG54340|CAIC) probable crotonobetaine/carnitine-CoA ligase from Escherichia coli strain O157:H7 (522 aa), FASTA scores: opt: 478, E(): 1.1e-20, (28.5% identity in 347 aa overlap); Q9KHL1|ENCH putative acyl-CoA ligase from Streptomyces maritimus (535 aa), FASTA scores: opt: 477, E(): 1.3e-20, (28.7% identity in 453 aa overlap); Q50017|XCLC|ML1051 acyl-CoA synthase from Mycobacterium leprae (476 aa), FASTA scores: opt: 472, E(): 2.3e-20, (31.35% identity in 469 aa overlap); P31552|CAIC_ECOLI|B0037 from Escherichia coli strain K12 (522 aa), FASTA scores: opt: 467, E(): 4.8e-20, (28.75% identity in 348 aa overlap); Q9KBC2|BH2006 from Bacillus halodurans long-chain acyl-CoA synthetase (ligase) (513 aa), FASTA scores: opt: 462, E(): 9.4e-20, (27.65% identity in 463 aa overlap); etc. Contains PS00455 Putative AMP-binding domain signature. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3924890 | 3926398 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3506|fadD17
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function
- Arora P et al. [2009]. Mechanistic and functional insights into fatty acid activation in Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant