Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but supposed involvement in lipid degradation.
ProductFatty-acid-CoA synthetase FadD17 (fatty-acid-CoA synthase) (fatty-acid-CoA ligase)
CommentsRv3506, (MTV023.13), len: 502 aa. fadD17, fatty-acid-CoA synthetase (ligase), similar to P72007|FADD1|RV1750c|MTCY28.13c|MTCY04C12.34 from Mycobacterium tuberculosis (532 aa), FASTA scores: opt: 666, E(): 9.8e-32, (52.05% identity in 488 aa overlap). Also similar to various ligases/synthetases e.g. Q9EY88|FCS feruloyl-CoA synthetase from Amycolatopsis sp. HR167 (491 aa), FASTA scores: opt: 490, E(): 2.1e-21, (30.3% identity in 462 aa overlap); BAB33463|ECS0040 (alias AAG54340|CAIC) probable crotonobetaine/carnitine-CoA ligase from Escherichia coli strain O157:H7 (522 aa), FASTA scores: opt: 478, E(): 1.1e-20, (28.5% identity in 347 aa overlap); Q9KHL1|ENCH putative acyl-CoA ligase from Streptomyces maritimus (535 aa), FASTA scores: opt: 477, E(): 1.3e-20, (28.7% identity in 453 aa overlap); Q50017|XCLC|ML1051 acyl-CoA synthase from Mycobacterium leprae (476 aa), FASTA scores: opt: 472, E(): 2.3e-20, (31.35% identity in 469 aa overlap); P31552|CAIC_ECOLI|B0037 from Escherichia coli strain K12 (522 aa), FASTA scores: opt: 467, E(): 4.8e-20, (28.75% identity in 348 aa overlap); Q9KBC2|BH2006 from Bacillus halodurans long-chain acyl-CoA synthetase (ligase) (513 aa), FASTA scores: opt: 462, E(): 9.4e-20, (27.65% identity in 463 aa overlap); etc. Contains PS00455 Putative AMP-binding domain signature.
Functional categoryLipid metabolism
ProteomicsIdentified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39248903926398+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3506|fadD17
MTPTHPTVTELLLPLSEIDDRGVYFEDSFTSWRDHIRHGAAIAAALRERLDPARPPHVGVLLQNTPFFSATLVAGALSGIVPVGLNPVRRGAALAGDIAKADCQLVLTGSGSAEVPADVEHINVDSPEWTDEVAAHRDTEVRFRSADLADLFMLIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVLATPELPDDADNPLRAVYGNEGVPGDIDRFGRRFGCVVMDGFGSTEGGVAITRTLDTPAGALGPLPGGIQIVDPDTGEPCPTGVVGELVNTAGPGGFEGYYNDEAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAPIERVLMRYPDATEVAVYPVPDPVVGDQVMAALVLAPGTKFDADKFRAFLTEQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR