Gene Rv3530c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv3530c, (MTCY03C7.26), len: 260 aa. Possible oxidoreductase, similar to various oxidoreductases and hypothetical proteins e.g. BAB53258|Q987E5|MLL7083 probable oxidoreductase from Rhizobium loti (Mesorhizobium loti) (258 aa), FASTA scores: opt: 405, E(): 5.3e-18, (33.45% identity in 263 aa overlap); Q9VNF3|CG12171 hypothetical protein from Drosophila melanogaster (Fruit fly) (257 aa), FASTA scores: opt: 404, E(): 6.1e-18, (32.8% identity in 256 aa overlap); Q9A3X5|CC3076 oxidoreductase (short-chain dehydrogenase/reductase family) from Caulobacter crescentus (254 aa), FASTA scores: opt: 400, E(): 1.1e-17, (31.0% identity in 255 aa overlap); BAB50080|MLR3115 dehydrogenase from Rhizobium loti (Mesorhizobium loti) (259 aa), FASTA scores: opt: 393, E(): 3e-17, (31.9% identity in 254 aa overlap); Q9F5J1|SIM-NJ1|SIMD2 putative 3-keto-acyl-reductase from Streptomyces antibioticus (273 aa), FASTA scores: opt: 388, E(): 6.3e-17, (31.6% identity in 250 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3967038 | 3967820 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3530c|Rv3530c
MTGMLKRKVIVVSGVGPGLGTTLAHRCARDGADLVLAARSAERLDDVAKQIIDTGRRAVAVRTDITDDDDVSNLVQATLAAYGKADVLINNAFRVPSMKPLAGTTFEHIRDAIELSALGTLRLIQAFTPALAQSHGAIVNVNSMVIRHSQPKYGTYKMAKSVLLAMSHSLATELGEQGIRVNSVAPGYIWGDTLKSYFDHQAGKYGTTVDQIYQATAANSDLKRLPTEDEVASAILFLASDLASGITGQTLDVNCGEYHT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Gurvitz A et al. [2008]. Function of heterologous Mycobacterium tuberculosis InhA, a type 2 fatty acid synthase enzyme involved in extending C20 fatty acids to C60-to-C90 mycolic acids, during de novo lipoic acid synthesis in Saccharomyces cerevisiae. Function
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
