Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible oxidoreductase
CommentsRv3530c, (MTCY03C7.26), len: 260 aa. Possible oxidoreductase, similar to various oxidoreductases and hypothetical proteins e.g. BAB53258|Q987E5|MLL7083 probable oxidoreductase from Rhizobium loti (Mesorhizobium loti) (258 aa), FASTA scores: opt: 405, E(): 5.3e-18, (33.45% identity in 263 aa overlap); Q9VNF3|CG12171 hypothetical protein from Drosophila melanogaster (Fruit fly) (257 aa), FASTA scores: opt: 404, E(): 6.1e-18, (32.8% identity in 256 aa overlap); Q9A3X5|CC3076 oxidoreductase (short-chain dehydrogenase/reductase family) from Caulobacter crescentus (254 aa), FASTA scores: opt: 400, E(): 1.1e-17, (31.0% identity in 255 aa overlap); BAB50080|MLR3115 dehydrogenase from Rhizobium loti (Mesorhizobium loti) (259 aa), FASTA scores: opt: 393, E(): 3e-17, (31.9% identity in 254 aa overlap); Q9F5J1|SIM-NJ1|SIMD2 putative 3-keto-acyl-reductase from Streptomyces antibioticus (273 aa), FASTA scores: opt: 388, E(): 6.3e-17, (31.6% identity in 250 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39670383967820-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3530c|Rv3530c
MTGMLKRKVIVVSGVGPGLGTTLAHRCARDGADLVLAARSAERLDDVAKQIIDTGRRAVAVRTDITDDDDVSNLVQATLAAYGKADVLINNAFRVPSMKPLAGTTFEHIRDAIELSALGTLRLIQAFTPALAQSHGAIVNVNSMVIRHSQPKYGTYKMAKSVLLAMSHSLATELGEQGIRVNSVAPGYIWGDTLKSYFDHQAGKYGTTVDQIYQATAANSDLKRLPTEDEVASAILFLASDLASGITGQTLDVNCGEYHT