Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, supposed involvement in lipid metabolism.
ProductProbable lipid transfer protein or keto acyl-CoA thiolase Ltp2
CommentsRv3540c, (MTCY03C7.16), len: 386 aa. Probable ltp2, lipid-transfer protein or keto acyl-CoA thiolase, similar to several e.g. Q9X4X2|DITF DITF protein (hypothetical protein, similar to non-specific lipid-transfer protein and 3-ketoacyl-CoA thiolase) from Pseudomonas abietaniphila (397 aa), FASTA scores: opt: 665, E(): 5.3e-34, (33.4% identity in 392 aa overlap); O30255|AF2416 3-ketoacyl-CoA thiolase (ACAB-12) from Archaeoglobus fulgidus (384 aa), FASTA scores: opt: 496, E(): 1.6e-23, (30.35% identity in 389 aa overlap); O28978|AF1291 3-ketoacyl-CoA thiolase (ACAB-11) from Archaeoglobus fulgidus (392 aa), FASTA scores: opt: 494, E(): 2.2e-23, (30.6% identity in 379 aa overlap); O26884|MTH793 lipid-transfer protein (sterol or nonspecific) from Methanobacterium thermoautotrophicum (383 aa), FASTA scores: opt: 487, E(): 5.9e-23, (30.4% identity in 388 aa overlap); etc.
Functional categoryLipid metabolism
OperonRv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39794993980659-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3540c|ltp2
VLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLTTFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVADVVVAYRAFNERSGMRFGQVQTRLTENADSTGVDNSFSYPHGLSTPAAQVAMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIEDHQNSRWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQGCSPDQYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFTPFTLIQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGMNGIAEGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG