Gene Rv3540c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, supposed involvement in lipid metabolism. |
| Product | Probable lipid transfer protein or keto acyl-CoA thiolase Ltp2 |
| Comments | Rv3540c, (MTCY03C7.16), len: 386 aa. Probable ltp2, lipid-transfer protein or keto acyl-CoA thiolase, similar to several e.g. Q9X4X2|DITF DITF protein (hypothetical protein, similar to non-specific lipid-transfer protein and 3-ketoacyl-CoA thiolase) from Pseudomonas abietaniphila (397 aa), FASTA scores: opt: 665, E(): 5.3e-34, (33.4% identity in 392 aa overlap); O30255|AF2416 3-ketoacyl-CoA thiolase (ACAB-12) from Archaeoglobus fulgidus (384 aa), FASTA scores: opt: 496, E(): 1.6e-23, (30.35% identity in 389 aa overlap); O28978|AF1291 3-ketoacyl-CoA thiolase (ACAB-11) from Archaeoglobus fulgidus (392 aa), FASTA scores: opt: 494, E(): 2.2e-23, (30.6% identity in 379 aa overlap); O26884|MTH793 lipid-transfer protein (sterol or nonspecific) from Methanobacterium thermoautotrophicum (383 aa), FASTA scores: opt: 487, E(): 5.9e-23, (30.4% identity in 388 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Operon | Rv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3979499 | 3980659 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3540c|ltp2
VLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLTTFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVADVVVAYRAFNERSGMRFGQVQTRLTENADSTGVDNSFSYPHGLSTPAAQVAMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIEDHQNSRWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQGCSPDQYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFTPFTLIQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGMNGIAEGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Chang JC et al. [2007]. Identification of Mycobacterial genes that alter growth and pathology in macrophages and in mice. Mutant Operon
- Chang JC et al. [2009]. igr Genes and Mycobacterium tuberculosis cholesterol metabolism. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant