Gene Rv3545c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Cytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. |
| Product | Probable cytochrome P450 125 Cyp125 |
| Comments | Rv3545c, (MT3649, MTCY03C7.11), len: 433 aa. Probable cyp125, cytochrome P-450, similar to others e.g. Q59723|LINC|CYP111 from Pseudomonas incognita (406 aa), FASTA scores: opt: 831, E(): 8e-45, (34.75% identity in 406 aa overlap); Q9X8Q3|CYP107P1|SCH10.14c from Streptomyces coelicolor (411 aa), FASTA scores: opt: 694, E(): 3.3e-36, (32.35% identity in 417 aa overlap); Q9L465|CYP162A1|NIKQ from Streptomyces tendae (396 aa) FASTA scores: opt: 664, E(): 2.5e-34, (34.15% identity in 413 aa overlap); O08469|CPXY_BACSU|CYPA|CYP107J1 from Bacillus subtilis (410 aa), FASTA scores: opt: 579, E(): 5.6e-29, (30.05% identity in 366 aa overlap); etc. Also similar to other from Mycobacterium tuberculosis e.g. Q50696|CYP124|Rv2266|MT2328|MTCY339.44c (428 aa) FASTA scores: opt: 1040, E(): 6.1e-58, (40.75% identity in 432 aa overlap). Belongs to the cytochrome P450 family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Operon | Rv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3984144 | 3985445 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3545c|cyp125
VSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Chang JC et al. [2007]. Identification of Mycobacterial genes that alter growth and pathology in macrophages and in mice. Mutant Operon
- Chang JC et al. [2009]. igr Genes and Mycobacterium tuberculosis cholesterol metabolism. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant